Lineage for d1iq8a1 (1iq8 A:6-360)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 174942Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 174943Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 174944Protein Archaeosine tRNA-guanine transglycosylase, N-terminal domain [75096] (1 species)
  7. 174945Species Archaeon Pyrococcus horikoshii [TaxId:53953] [75097] (3 PDB entries)
  8. 174946Domain d1iq8a1: 1iq8 A:6-360 [71270]
    Other proteins in same PDB: d1iq8a2, d1iq8b2

Details for d1iq8a1

PDB Entry: 1iq8 (more details), 2.2 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase from pyrococcus horikoshii

SCOP Domain Sequences for d1iq8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iq8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii}
kmlkfeikardgagrigklevngkkietpaimpvvnpkqmvvepkelekmgfeiiitnsy
iiykdeelrrkalelgihrmldyngiievdsgsfqlmkygsievsnreiiefqhrigvdi
gtfldiptppdapreqavkeleitlsrareaeeikeipmnatiqgstytdlrryaarrls
smnfeihpiggvvpllesyrfrdvvdivisskmalrpdrpvhlfgaghpivfalavamgv
dlfdsasyalyakddrymtpegtkrldeldyfpcscpvcskytpqelrempkeertrlla
lhnlwvikeeikrvkqaikegelwrlvderarshpklysaykrllehytfleefe

SCOP Domain Coordinates for d1iq8a1:

Click to download the PDB-style file with coordinates for d1iq8a1.
(The format of our PDB-style files is described here.)

Timeline for d1iq8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iq8a2