SCOPe 2.05: Domain d1ipkb1: 1ipk B:9-174

Lineage for d1ipkb1 (1ipk B:9-174)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Soybean (Glycine max), beta-conglycinin beta subunit [TaxId:3847] [109608] (3 PDB entries)
   Uniprot P25974

8. Domain d1ipkb1: 1ipk B:9-174 [71266]

Details for d1ipkb1

PDB Entry: 1ipk, 2.7 Å

PDB Description: crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers

PDB Compounds: (B:) beta-conglycinin, beta chain

SCOPe Domain Sequences for d1ipkb1:

Sequence; same for both SEQRES and ATOM records:

>d1ipkb1 b.82.1.2 (B:9-174) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]}
npfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillphhad
adfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkiiklaip
vnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlf

Timeline for d1ipkb1:

• d1ipkb1 first appeared in SCOP 1.61
  
• d1ipkb1 appears in SCOPe 2.04
  
• d1ipkb1 appears in SCOPe 2.06
  
• d1ipkb1 appears in the current release, SCOPe 2.08