Lineage for d1ipja2 (1ipj A:183-393)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234509Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 234510Superfamily b.82.1: RmlC-like cupins [51182] (6 families) (S)
  5. 234521Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 234539Protein Seed storage 7S protein [51188] (4 species)
    duplication: consists of two germine-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 234574Species Soybean (Glycine max), beta-conglycinin [75032] (2 PDB entries)
  8. 234576Domain d1ipja2: 1ipj A:183-393 [71259]

Details for d1ipja2

PDB Entry: 1ipj (more details), 2.7 Å

PDB Description: crystal structures of recombinant and native soybean beta-conglycinin beta homotrimers complexes with n-acetyl-d-glucosamine

SCOP Domain Sequences for d1ipja2:

Sequence, based on SEQRES records: (download)

>d1ipja2 b.82.1.2 (A:183-393) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin}
qqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpekn
pqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeeep
levqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqi
erqvqelafpgsaqdverllkkqresyfvda

Sequence, based on observed residues (ATOM records): (download)

>d1ipja2 b.82.1.2 (A:183-393) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin}
qqegvivelsaksssrktissedepfnlrsrnpiysnnfgkffeitpeknpqlrdldifl
ssvdinegalllphfnskaivilvinegdanielvgiklevqryraelseddvfvipaay
pfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaqdverllkk
qresyfvda

SCOP Domain Coordinates for d1ipja2:

Click to download the PDB-style file with coordinates for d1ipja2.
(The format of our PDB-style files is described here.)

Timeline for d1ipja2: