Lineage for d1inqa2 (1inq A:1-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2183015Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (27 PDB entries)
  8. 2183022Domain d1inqa2: 1inq A:1-181 [71248]
    Other proteins in same PDB: d1inqa1, d1inqb_
    complexed with dms

Details for d1inqa2

PDB Entry: 1inq (more details), 2.2 Å

PDB Description: Structure of Minor Histocompatibility Antigen peptide, H13a, complexed to H2-Db
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1inqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1inqa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d1inqa2:

Click to download the PDB-style file with coordinates for d1inqa2.
(The format of our PDB-style files is described here.)

Timeline for d1inqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1inqa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1inqb_