Lineage for d1inqa2 (1inq A:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600377Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)
  8. 600379Domain d1inqa2: 1inq A:1-181 [71248]
    Other proteins in same PDB: d1inqa1, d1inqb_
    complexed with dms

Details for d1inqa2

PDB Entry: 1inq (more details), 2.2 Å

PDB Description: Structure of Minor Histocompatibility Antigen peptide, H13a, complexed to H2-Db

SCOP Domain Sequences for d1inqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1inqa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOP Domain Coordinates for d1inqa2:

Click to download the PDB-style file with coordinates for d1inqa2.
(The format of our PDB-style files is described here.)

Timeline for d1inqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1inqa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1inqb_