SCOP 1.63: Domain d1inqa1: 1inq A:182-275

Lineage for d1inqa1 (1inq A:182-275)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (13 PDB entries)

8. Domain d1inqa1: 1inq A:182-275 [71247]
   Other proteins in same PDB: d1inqa2
   complexed with dms

Details for d1inqa1

PDB Entry: 1inq, 2.2 Å

PDB Description: Structure of Minor Histocompatibility Antigen peptide, H13a, complexed to H2-Db

SCOP Domain Sequences for d1inqa1:

Sequence; same for both SEQRES and ATOM records:

>d1inqa1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwe

Timeline for d1inqa1:

• d1inqa1 first appeared in SCOP 1.61
  
• d1inqa1 appears in SCOP 1.65
  
• d1inqa1 appears in the current release, SCOPe 2.07