SCOPe 2.06: Domain d1imja_: 1imj A:

Lineage for d1imja_ (1imj A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.23: Ccg1/TafII250-interacting factor B (Cib) [75285] (1 protein)

6. Protein Ccg1/TafII250-interacting factor B (Cib) [75286] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75287] (1 PDB entry)

8. Domain d1imja_: 1imj A: [71246]
   complexed with so4

Details for d1imja_

PDB Entry: 1imj, 2.2 Å

PDB Description: crystal structure of the human ccg1/tafii250-interacting factor b (cib)

PDB Compounds: (A:) ccg1-interacting factor b

SCOPe Domain Sequences for d1imja_:

Sequence; same for both SEQRES and ATOM records:

>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}
aasveqregtiqvqgqalffrealpgsgqarfsvlllhgirfssetwqnlgtlhrlaqag
yravaidlpglghskeaaapapigelapgsflaavvdalelgppvvispslsgmyslpfl
tapgsqlpgfvpvapictdkinaanyasvktpalivygdqdpmgqtsfehlkqlpnhrvl
imkgaghpcyldkpeewhtglldflqgl

Timeline for d1imja_:

• d1imja_ first appeared in SCOP 1.61
  
• d1imja_ appears in SCOPe 2.05
  
• d1imja_ appears in SCOPe 2.07
  
• d1imja_ appears in the current release, SCOPe 2.08