Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins) |
Protein Mapk phosphatase [52803] (2 species) |
Species Human (Homo sapiens), pac-1 [TaxId:9606] [75232] (1 PDB entry) |
Domain d1ikza_: 1ikz A: [71244] mutant |
PDB Entry: 1ikz (more details)
SCOP Domain Sequences for d1ikza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ikza_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1} pveilpylflgscshssdlqglqacgitavlnvsascpnhfeglfryksipvednqmvei sawfqeaigfidwvknsggrvlvhsqagisrsaticlaylmqsrrvrldeafdfvkqrrg vispnfsfmgqllqfetqvlch
Timeline for d1ikza_: