Lineage for d1ikza_ (1ikz A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244631Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432
  4. 244632Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 244633Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins)
  6. 244643Protein Mapk phosphatase [52803] (2 species)
  7. 244644Species Human (Homo sapiens), pac-1 [TaxId:9606] [75232] (1 PDB entry)
  8. 244645Domain d1ikza_: 1ikz A: [71244]
    mutant

Details for d1ikza_

PDB Entry: 1ikz (more details)

PDB Description: solution structure of the catalytic domain of mapk phosphatase pac-1: insights into substrate-induced enzymatic activation

SCOP Domain Sequences for d1ikza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ikza_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1}
pveilpylflgscshssdlqglqacgitavlnvsascpnhfeglfryksipvednqmvei
sawfqeaigfidwvknsggrvlvhsqagisrsaticlaylmqsrrvrldeafdfvkqrrg
vispnfsfmgqllqfetqvlch

SCOP Domain Coordinates for d1ikza_:

Click to download the PDB-style file with coordinates for d1ikza_.
(The format of our PDB-style files is described here.)

Timeline for d1ikza_: