Lineage for d1ikop_ (1iko P:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 792107Family b.6.1.5: Ephrin ectodomain [74874] (2 proteins)
    eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
  6. 792113Protein Ephrin-b2 ectodomain [74875] (1 species)
  7. 792114Species Mouse (Mus musculus) [TaxId:10090] [74876] (3 PDB entries)
  8. 792115Domain d1ikop_: 1iko P: [71243]
    complexed with man, nag

Details for d1ikop_

PDB Entry: 1iko (more details), 1.92 Å

PDB Description: crystal structure of the murine ephrin-b2 ectodomain
PDB Compounds: (P:) ephrin-b2

SCOP Domain Sequences for d1ikop_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]}
sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
drctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegld
nqeggvcqtramkilmkvgqd

SCOP Domain Coordinates for d1ikop_:

Click to download the PDB-style file with coordinates for d1ikop_.
(The format of our PDB-style files is described here.)

Timeline for d1ikop_: