SCOPe 2.07: Domain d1ijza1: 1ijz A:2-113

Lineage for d1ijza1 (1ijz A:2-113)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-13 (IL-13) [63532] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63533] (13 PDB entries)

8. Domain d1ijza1: 1ijz A:2-113 [71239]
   Other proteins in same PDB: d1ijza2

Details for d1ijza1

PDB Entry: 1ijz

PDB Description: solution structure of human il-13

PDB Compounds: (A:) interleukin-13

SCOPe Domain Sequences for d1ijza1:

Sequence; same for both SEQRES and ATOM records:

>d1ijza1 a.26.1.2 (A:2-113) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
gpvppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaie
ktqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn

Timeline for d1ijza1:

• d1ijza1 first appeared in SCOP 1.61, called d1ijza_
  
• d1ijza1 appears in SCOPe 2.06
  
• d1ijza1 appears in the current release, SCOPe 2.08