SCOPe 2.07: Domain d1ijkc_: 1ijk C:

Lineage for d1ijkc_ (1ijk C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin beta chain [88867] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88870] (4 PDB entries)

8. Domain d1ijkc_: 1ijk C: [71236]
   Other proteins in same PDB: d1ijka_, d1ijkb_
   complexed with the von Willebrand factor a1 domain
   mutant

Details for d1ijkc_

PDB Entry: 1ijk, 2.6 Å

PDB Description: the von willebrand factor mutant (i546v) a1 domain-botrocetin complex

PDB Compounds: (C:) Botrocetin

SCOPe Domain Sequences for d1ijkc_:

Sequence, based on SEQRES records:

>d1ijkc_ d.169.1.1 (C:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
cefqa

Sequence, based on observed residues (ATOM records):

>d1ijkc_ d.169.1.1 (C:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrslgdvvwi
glsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfvcefqa

Timeline for d1ijkc_:

• d1ijkc_ first appeared in SCOP 1.61
  
• d1ijkc_ appears in SCOPe 2.06
  
• d1ijkc_ appears in the current release, SCOPe 2.08