Lineage for d1ijkc_ (1ijk C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198738Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 198739Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 198740Family d.169.1.1: C-type lectin domain [56437] (18 proteins)
  6. 198928Protein Snake coagglutinin [56446] (5 species)
  7. 198941Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [56449] (2 PDB entries)
  8. 198947Domain d1ijkc_: 1ijk C: [71236]
    Other proteins in same PDB: d1ijka_

Details for d1ijkc_

PDB Entry: 1ijk (more details), 2.6 Å

PDB Description: the von willebrand factor mutant (i546v) a1 domain-botrocetin complex

SCOP Domain Sequences for d1ijkc_:

Sequence, based on SEQRES records: (download)

>d1ijkc_ d.169.1.1 (C:) Snake coagglutinin {Jararaca (Bothrops jararaca), botrocetin}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
cefqa

Sequence, based on observed residues (ATOM records): (download)

>d1ijkc_ d.169.1.1 (C:) Snake coagglutinin {Jararaca (Bothrops jararaca), botrocetin}
dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrslgdvvwi
glsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfvcefqa

SCOP Domain Coordinates for d1ijkc_:

Click to download the PDB-style file with coordinates for d1ijkc_.
(The format of our PDB-style files is described here.)

Timeline for d1ijkc_: