Lineage for d1ijka_ (1ijk A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500013Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2500014Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2500015Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2500143Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)
  7. 2500144Species Human (Homo sapiens) [TaxId:9606] [53307] (10 PDB entries)
  8. 2500153Domain d1ijka_: 1ijk A: [71234]
    Other proteins in same PDB: d1ijkb_, d1ijkc_
    complexed with botrocetin
    mutant

Details for d1ijka_

PDB Entry: 1ijk (more details), 2.6 Å

PDB Description: the von willebrand factor mutant (i546v) a1 domain-botrocetin complex
PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d1ijka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijka_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
pplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrvsqkwvrvavveyhdg
shayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialll
masqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvd
eleqqrdeivsylcdlape

SCOPe Domain Coordinates for d1ijka_:

Click to download the PDB-style file with coordinates for d1ijka_.
(The format of our PDB-style files is described here.)

Timeline for d1ijka_: