Lineage for d1ihyc1 (1ihy C:1-148,C:313-334)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828863Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1828979Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [51811] (5 PDB entries)
  8. 1828992Domain d1ihyc1: 1ihy C:1-148,C:313-334 [71223]
    Other proteins in same PDB: d1ihya2, d1ihyb2, d1ihyc2, d1ihyd2
    complexed with apr, so4

Details for d1ihyc1

PDB Entry: 1ihy (more details), 3 Å

PDB Description: GAPDH complexed with ADP-ribose
PDB Compounds: (C:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1ihyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihyc1 c.2.1.3 (C:1-148,C:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]}
skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

SCOPe Domain Coordinates for d1ihyc1:

Click to download the PDB-style file with coordinates for d1ihyc1.
(The format of our PDB-style files is described here.)

Timeline for d1ihyc1: