Lineage for d1ihyb2 (1ihy B:149-312)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203128Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2203219Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species)
  7. 2203341Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [55359] (5 PDB entries)
  8. 2203353Domain d1ihyb2: 1ihy B:149-312 [71222]
    Other proteins in same PDB: d1ihya1, d1ihyb1, d1ihyc1, d1ihyd1
    complexed with apr, so4

Details for d1ihyb2

PDB Entry: 1ihy (more details), 3 Å

PDB Description: GAPDH complexed with ADP-ribose
PDB Compounds: (B:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1ihyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihyb2 d.81.1.1 (B:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamktasegplq
gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd

SCOPe Domain Coordinates for d1ihyb2:

Click to download the PDB-style file with coordinates for d1ihyb2.
(The format of our PDB-style files is described here.)

Timeline for d1ihyb2: