Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [51811] (5 PDB entries) |
Domain d1ihyb1: 1ihy B:1-148,B:313-334 [71221] Other proteins in same PDB: d1ihya2, d1ihyb2, d1ihyc2, d1ihyd2 complexed with apr, so4 |
PDB Entry: 1ihy (more details), 3 Å
SCOPe Domain Sequences for d1ihyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihyb1 c.2.1.3 (B:1-148,B:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa
Timeline for d1ihyb1: