Lineage for d1ihyb1 (1ihy B:1-148,B:313-334)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 238741Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 238834Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)
  7. 238916Species Lobster (Palinurus versicolor) [51811] (5 PDB entries)
  8. 238928Domain d1ihyb1: 1ihy B:1-148,B:313-334 [71221]
    Other proteins in same PDB: d1ihya2, d1ihyb2, d1ihyc2, d1ihyd2

Details for d1ihyb1

PDB Entry: 1ihy (more details), 3 Å

PDB Description: GAPDH complexed with ADP-ribose

SCOP Domain Sequences for d1ihyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihyb1 c.2.1.3 (B:1-148,B:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)}
skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

SCOP Domain Coordinates for d1ihyb1:

Click to download the PDB-style file with coordinates for d1ihyb1.
(The format of our PDB-style files is described here.)

Timeline for d1ihyb1: