SCOPe 2.01: Domain d1ihya1: 1ihy A:1-148,A:313-334

Lineage for d1ihya1 (1ihy A:1-148,A:313-334)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [51811] (5 PDB entries)

8. Domain d1ihya1: 1ihy A:1-148,A:313-334 [71219]
   Other proteins in same PDB: d1ihya2, d1ihyb2, d1ihyc2, d1ihyd2
   complexed with apr, so4

Details for d1ihya1

PDB Entry: 1ihy, 3 Å

PDB Description: GAPDH complexed with ADP-ribose

PDB Compounds: (A:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1ihya1:

Sequence; same for both SEQRES and ATOM records:

>d1ihya1 c.2.1.3 (A:1-148,A:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]}
skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

Timeline for d1ihya1:

• d1ihya1 first appeared in SCOP 1.61
  
• d1ihya1 appears in SCOP 1.75
  
• d1ihya1 appears in SCOPe 2.02
  
• d1ihya1 appears in the current release, SCOPe 2.08