Lineage for d1ihxc2 (1ihx C:149-312)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331066Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 331067Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 331068Family d.81.1.1: GAPDH-like [55348] (3 proteins)
    has many additional secondary structures
  6. 331086Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (14 species)
  7. 331187Species Lobster (Palinurus versicolor) [55359] (5 PDB entries)
  8. 331196Domain d1ihxc2: 1ihx C:149-312 [71216]
    Other proteins in same PDB: d1ihxa1, d1ihxb1, d1ihxc1, d1ihxd1

Details for d1ihxc2

PDB Entry: 1ihx (more details), 2.8 Å

PDB Description: Crystal structure of two D-glyceraldehyde-3-phosphate dehydrogenase complexes: a case of asymmetry

SCOP Domain Sequences for d1ihxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihxc2 d.81.1.1 (C:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamktasegplq
gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd

SCOP Domain Coordinates for d1ihxc2:

Click to download the PDB-style file with coordinates for d1ihxc2.
(The format of our PDB-style files is described here.)

Timeline for d1ihxc2: