| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
| Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [51811] (5 PDB entries) |
| Domain d1ihxc1: 1ihx C:1-148,C:313-334 [71215] Other proteins in same PDB: d1ihxa2, d1ihxb2, d1ihxc2, d1ihxd2 complexed with snd, so4 |
PDB Entry: 1ihx (more details), 2.8 Å
SCOPe Domain Sequences for d1ihxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihxc1 c.2.1.3 (C:1-148,C:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]}
skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa
Timeline for d1ihxc1: