SCOPe 2.08: Domain d1ifwa1: 1ifw A:6-92

Lineage for d1ifwa1 (1ifw A:6-92)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.144: PABP domain-like [63569] (2 superfamilies)
   4 helices; an orthogonal array

4. Superfamily a.144.1: PABC (PABP) domain [63570] (2 families)

5. Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)

6. Protein poly(A) binding protein [63572] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74730] (1 PDB entry)

8. Domain d1ifwa1: 1ifw A:6-92 [71206]
   Other proteins in same PDB: d1ifwa2

Details for d1ifwa1

PDB Entry: 1ifw

PDB Description: solution structure of c-terminal domain of poly(a) binding protein from saccharomyces cerevisiae

PDB Compounds: (A:) polyadenylate-binding protein, cytoplasmic and nuclear

SCOPe Domain Sequences for d1ifwa1:

Sequence; same for both SEQRES and ATOM records:

>d1ifwa1 a.144.1.1 (A:6-92) poly(A) binding protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
prnandnnqfyqqkqrqalgeqlykkvsaktsneeaagkitgmildlppqevfpllesde
lfeqhykeasaayesfkkeqeqqteqa

Timeline for d1ifwa1:

• d1ifwa1 first appeared in SCOP 1.61, called d1ifwa_
  
• d1ifwa1 appears in SCOPe 2.07