Lineage for d1ifvb_ (1ifv B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 196532Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 196660Superfamily d.129.3: Bet v1-like [55961] (4 families) (S)
  5. 196661Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (2 proteins)
  6. 196675Protein Plant pathogenesis-related protein PR10 [75543] (1 species)
  7. 196676Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (2 PDB entries)
  8. 196679Domain d1ifvb_: 1ifv B: [71205]

Details for d1ifvb_

PDB Entry: 1ifv (more details), 2.25 Å

PDB Description: crystal structure of pathogenesis-related protein llpr10.1b from yellow lupine

SCOP Domain Sequences for d1ifvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifvb_ d.129.3.1 (B:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus)}
gvfafedehpsavaqaklfkaltkdsddiipkvieqiqsveivegnggpgtvkkitashg
ghtsyvlhkidaideasfeynysivggtgldeslekitfeskllsgpdggsigkikvkfh
tkgdvlsdavreeakargtglfkavegyvlanpny

SCOP Domain Coordinates for d1ifvb_:

Click to download the PDB-style file with coordinates for d1ifvb_.
(The format of our PDB-style files is described here.)

Timeline for d1ifvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ifva_