SCOPe 2.06: Domain d1ifva_: 1ifv A:

Lineage for d1ifva_ (1ifv A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)

6. Protein Plant pathogenesis-related protein PR10 [75543] (2 species)

7. Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (6 PDB entries)

8. Domain d1ifva_: 1ifv A: [71204]
   isoform llpr10.1b

Details for d1ifva_

PDB Entry: 1ifv, 2.25 Å

PDB Description: crystal structure of pathogenesis-related protein llpr10.1b from yellow lupine

PDB Compounds: (A:) protein llr18b

SCOPe Domain Sequences for d1ifva_:

Sequence; same for both SEQRES and ATOM records:

>d1ifva_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gvfafedehpsavaqaklfkaltkdsddiipkvieqiqsveivegnggpgtvkkitashg
ghtsyvlhkidaideasfeynysivggtgldeslekitfeskllsgpdggsigkikvkfh
tkgdvlsdavreeakargtglfkavegyvlanpny

Timeline for d1ifva_:

• d1ifva_ first appeared in SCOP 1.61
  
• d1ifva_ appears in SCOPe 2.05
  
• d1ifva_ appears in SCOPe 2.07
  
• d1ifva_ appears in the current release, SCOPe 2.08