Lineage for d1ifva_ (1ifv A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1669085Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1669086Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 1669129Protein Plant pathogenesis-related protein PR10 [75543] (2 species)
  7. 1669132Species Yellow lupine (Lupinus luteus) [TaxId:3873] [75544] (3 PDB entries)
  8. 1669136Domain d1ifva_: 1ifv A: [71204]
    isoform llpr10.1b

Details for d1ifva_

PDB Entry: 1ifv (more details), 2.25 Å

PDB Description: crystal structure of pathogenesis-related protein llpr10.1b from yellow lupine
PDB Compounds: (A:) protein llr18b

SCOPe Domain Sequences for d1ifva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifva_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]}
gvfafedehpsavaqaklfkaltkdsddiipkvieqiqsveivegnggpgtvkkitashg
ghtsyvlhkidaideasfeynysivggtgldeslekitfeskllsgpdggsigkikvkfh
tkgdvlsdavreeakargtglfkavegyvlanpny

SCOPe Domain Coordinates for d1ifva_:

Click to download the PDB-style file with coordinates for d1ifva_.
(The format of our PDB-style files is described here.)

Timeline for d1ifva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ifvb_