SCOPe 2.06: Domain d1ieha1: 1ieh A:1-130

Lineage for d1ieha1 (1ieh A:1-130)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)

7. Species Llama (Lama glama) [TaxId:9844] [88565] (7 PDB entries)

8. Domain d1ieha1: 1ieh A:1-130 [71199]
   Other proteins in same PDB: d1ieha2
   VHh BRUC.D4.4

Details for d1ieha1

PDB Entry: 1ieh

PDB Description: solution structure of a soluble single-domain antibody with hydrophobic residues typical of a vl/vh interface

PDB Compounds: (A:) bruc.d4.4

SCOPe Domain Sequences for d1ieha1:

Sequence; same for both SEQRES and ATOM records:

>d1ieha1 b.1.1.1 (A:1-130) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
dvqlqasggglvqpggslrvscaasgftfssyhmawvrqapgkglewvstinpgdgstyy
adsvkgrftisrdnakntlylqmnslksedtavyycakysggaldawgqgtqvtvssqse
qkliseedln

Timeline for d1ieha1:

• d1ieha1 first appeared in SCOP 1.61, called d1ieha_
  
• d1ieha1 was called d1ieha_ in SCOPe 2.05
  
• d1ieha1 appears in SCOPe 2.07
  
• d1ieha1 appears in the current release, SCOPe 2.08