| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) |
| Species Llama (Lama glama) [TaxId:9844] [88565] (7 PDB entries) |
| Domain d1ieha_: 1ieh A: [71199] VHh BRUC.D4.4 |
PDB Entry: 1ieh (more details)
SCOPe Domain Sequences for d1ieha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]}
dvqlqasggglvqpggslrvscaasgftfssyhmawvrqapgkglewvstinpgdgstyy
adsvkgrftisrdnakntlylqmnslksedtavyycakysggaldawgqgtqvtvssqse
qkliseedlnhhhhh
Timeline for d1ieha_: