Lineage for d1ie4c_ (1ie4 C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113483Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1113484Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
  6. 1113485Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 1113850Species Norway rat (Rattus norvegicus) [TaxId:10116] [49476] (4 PDB entries)
  8. 1113861Domain d1ie4c_: 1ie4 C: [71197]
    complexed with t44

Details for d1ie4c_

PDB Entry: 1ie4 (more details), 2.5 Å

PDB Description: rat transthyretin complex with thyroxine (t4)
PDB Compounds: (C:) Transthyretin

SCOPe Domain Sequences for d1ie4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ie4c_ b.3.4.1 (C:) Transthyretin (synonym: prealbumin) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg
vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn

SCOPe Domain Coordinates for d1ie4c_:

Click to download the PDB-style file with coordinates for d1ie4c_.
(The format of our PDB-style files is described here.)

Timeline for d1ie4c_: