Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) |
Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein) |
Protein Transthyretin (synonym: prealbumin) [49474] (4 species) sandwich; 8 strands in 2 sheets |
Species Rat (Rattus norvegicus) [TaxId:10116] [49476] (4 PDB entries) |
Domain d1ie4c_: 1ie4 C: [71197] |
PDB Entry: 1ie4 (more details), 2.5 Å
SCOP Domain Sequences for d1ie4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ie4c_ b.3.4.1 (C:) Transthyretin (synonym: prealbumin) {Rat (Rattus norvegicus) [TaxId: 10116]} skcplmvkvldavrgspavdvavkvfkktadgswepfasgktaesgelhglttdekfteg vyrveldtksywkalgispfheyaevvftandsghrhytiaallspysysttavvsnpqn
Timeline for d1ie4c_: