Lineage for d1ictb_ (1ict B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457077Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 457207Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 457208Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 457209Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 457230Species Human (Homo sapiens) [TaxId:9606] [49475] (48 PDB entries)
  8. 457334Domain d1ictb_: 1ict B: [71184]

Details for d1ictb_

PDB Entry: 1ict (more details), 3 Å

PDB Description: monoclinic form of human transthyretin complexed with thyroxine (t4)

SCOP Domain Sequences for d1ictb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ictb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

SCOP Domain Coordinates for d1ictb_:

Click to download the PDB-style file with coordinates for d1ictb_.
(The format of our PDB-style files is described here.)

Timeline for d1ictb_: