SCOPe 2.08: Domain d1ib8a1: 1ib8 A:91-164

Lineage for d1ib8a1 (1ib8 A:91-164)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.2: YhbC-like, C-terminal domain [74942] (1 family)

5. Family b.38.2.1: YhbC-like, C-terminal domain [74943] (1 protein)

6. Protein Hypothetical protein SP14.3 (SP0552) [74944] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [74945] (1 PDB entry)

8. Domain d1ib8a1: 1ib8 A:91-164 [71168]
   Other proteins in same PDB: d1ib8a2
   structural genomics

Details for d1ib8a1

PDB Entry: 1ib8

PDB Description: solution structure and function of a conserved protein sp14.3 encoded by an essential streptococcus pneumoniae gene

PDB Compounds: (A:) conserved protein sp14.3

SCOPe Domain Sequences for d1ib8a1:

Sequence; same for both SEQRES and ATOM records:

>d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
rplktkdavagavgkyihvglyqaidkqkvfegtllafeedeltmeymdktrkktvqipy
slvskarlavklle

Timeline for d1ib8a1:

• d1ib8a1 first appeared in SCOP 1.61
  
• d1ib8a1 appears in SCOPe 2.07