| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
| Protein Fusion glycoprotein E1 [74840] (1 species) |
| Species Semliki forest virus [TaxId:11033] [74841] (3 PDB entries) |
| Domain d1i9wa1: 1i9w A:293-380 [71163] Other proteins in same PDB: d1i9wa2 |
PDB Entry: 1i9w (more details)
SCOPe Domain Sequences for d1i9wa1:
Sequence, based on SEQRES records: (download)
>d1i9wa1 b.1.18.4 (A:293-380) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsasc
>d1i9wa1 b.1.18.4 (A:293-380) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]}
aptiidltctvatcthsvltltyktnkngdcsvhshsnvatlqeatakvtlhfstasasp
sfvvslcsaratcsasc
Timeline for d1i9wa1: