Lineage for d1i9ry2 (1i9r Y:112-215)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549708Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549841Domain d1i9ry2: 1i9r Y:112-215 [71162]
    Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rh2, d1i9rk1, d1i9rk2, d1i9rl1, d1i9rm1, d1i9rx1, d1i9rx2, d1i9ry1
    part of Fab 5C8 against C40 ligand
    complexed with zn

Details for d1i9ry2

PDB Entry: 1i9r (more details), 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

SCOP Domain Sequences for d1i9ry2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9ry2 b.1.1.2 (Y:112-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1i9ry2:

Click to download the PDB-style file with coordinates for d1i9ry2.
(The format of our PDB-style files is described here.)

Timeline for d1i9ry2: