Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Engineered (including hybrid species) [88533] (63 PDB entries) SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody |
Domain d1i9ry1: 1i9r Y:1-111 [71161] Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rh2, d1i9rk1, d1i9rk2, d1i9rl2, d1i9rm2, d1i9rx1, d1i9rx2, d1i9ry2 part of humanized Fab 5C8 against C40 ligand complexed with zn |
PDB Entry: 1i9r (more details), 3.1 Å
SCOPe Domain Sequences for d1i9ry1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9ry1 b.1.1.1 (Y:1-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleik
Timeline for d1i9ry1: