Lineage for d1i9ry1 (1i9r Y:1-111)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652981Species Engineered (including hybrid species) [88533] (52 PDB entries)
  8. 653045Domain d1i9ry1: 1i9r Y:1-111 [71161]
    Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rh2, d1i9rk1, d1i9rk2, d1i9rl2, d1i9rm2, d1i9rx1, d1i9rx2, d1i9ry2
    part of humanized Fab 5C8 against C40 ligand
    complexed with zn

Details for d1i9ry1

PDB Entry: 1i9r (more details), 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody
PDB Compounds: (Y:) immunoglobulin l

SCOP Domain Sequences for d1i9ry1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9ry1 b.1.1.1 (Y:1-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleik

SCOP Domain Coordinates for d1i9ry1:

Click to download the PDB-style file with coordinates for d1i9ry1.
(The format of our PDB-style files is described here.)

Timeline for d1i9ry1: