SCOP 1.63: Domain d1i9ry1: 1i9r Y:1-111

Lineage for d1i9ry1 (1i9r Y:1-111)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 5C8 against C40 ligand, (human), kappa L chain [74813] (1 PDB entry)

8. Domain d1i9ry1: 1i9r Y:1-111 [71161]
   Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh2, d1i9rk2, d1i9rl2, d1i9rm2, d1i9rx2, d1i9ry2

Details for d1i9ry1

PDB Entry: 1i9r, 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

SCOP Domain Sequences for d1i9ry1:

Sequence; same for both SEQRES and ATOM records:

>d1i9ry1 b.1.1.1 (Y:1-111) Immunoglobulin (variable domains of L and H chains) {Fab 5C8 against C40 ligand, (human), kappa L chain}
divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleik

Timeline for d1i9ry1:

• d1i9ry1 first appeared in SCOP 1.61
  
• d1i9ry1 appears in SCOP 1.65
  
• d1i9ry1 appears in the current release, SCOPe 2.08