Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab 5C8 against C40 ligand, (human), kappa L chain [74813] (1 PDB entry) |
Domain d1i9ry1: 1i9r Y:1-111 [71161] Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh2, d1i9rk2, d1i9rl2, d1i9rm2, d1i9rx2, d1i9ry2 |
PDB Entry: 1i9r (more details), 3.1 Å
SCOP Domain Sequences for d1i9ry1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9ry1 b.1.1.1 (Y:1-111) Immunoglobulin (variable domains of L and H chains) {Fab 5C8 against C40 ligand, (human), kappa L chain} divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleik
Timeline for d1i9ry1: