Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
Domain d1i9rx2: 1i9r X:119-219 [71160] Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rk1, d1i9rl1, d1i9rl2, d1i9rm1, d1i9rm2, d1i9rx1, d1i9ry1, d1i9ry2 part of Fab 5C8 against C40 ligand complexed with zn |
PDB Entry: 1i9r (more details), 3.1 Å
SCOPe Domain Sequences for d1i9rx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9rx2 b.1.1.2 (X:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1i9rx2: