SCOP 1.63: Domain d1i9rx2: 1i9r X:119-219

Lineage for d1i9rx2 (1i9r X:119-219)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab 5C8 against C40 ligand, (human), kappa L chain [74830] (1 PDB entry)

8. Domain d1i9rx2: 1i9r X:119-219 [71160]
   Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rk1, d1i9rl1, d1i9rm1, d1i9rx1, d1i9ry1
   complexed with zn

Details for d1i9rx2

PDB Entry: 1i9r, 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

SCOP Domain Sequences for d1i9rx2:

Sequence; same for both SEQRES and ATOM records:

>d1i9rx2 b.1.1.2 (X:119-219) Immunoglobulin (constant domains of L and H chains) {Fab 5C8 against C40 ligand, (human), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1i9rx2:

• d1i9rx2 first appeared in SCOP 1.61
  
• d1i9rx2 appears in SCOP 1.65
  
• d1i9rx2 appears in the current release, SCOPe 2.08