Lineage for d1i9rm2 (1i9r M:112-215)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159637Species Fab 5C8 against C40 ligand, (human), kappa L chain [74830] (1 PDB entry)
  8. 159641Domain d1i9rm2: 1i9r M:112-215 [71158]
    Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rk1, d1i9rl1, d1i9rm1, d1i9rx1, d1i9ry1

Details for d1i9rm2

PDB Entry: 1i9r (more details), 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

SCOP Domain Sequences for d1i9rm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9rm2 b.1.1.2 (M:112-215) Immunoglobulin (constant domains of L and H chains) {Fab 5C8 against C40 ligand, (human), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1i9rm2:

Click to download the PDB-style file with coordinates for d1i9rm2.
(The format of our PDB-style files is described here.)

Timeline for d1i9rm2: