SCOP 1.61: Domain d1i9rm2: 1i9r M:112-215

Lineage for d1i9rm2 (1i9r M:112-215)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab 5C8 against C40 ligand, (human), kappa L chain [74830] (1 PDB entry)

8. Domain d1i9rm2: 1i9r M:112-215 [71158]
   Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rk1, d1i9rl1, d1i9rm1, d1i9rx1, d1i9ry1

Details for d1i9rm2

PDB Entry: 1i9r, 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

SCOP Domain Sequences for d1i9rm2:

Sequence; same for both SEQRES and ATOM records:

>d1i9rm2 b.1.1.2 (M:112-215) Immunoglobulin (constant domains of L and H chains) {Fab 5C8 against C40 ligand, (human), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d1i9rm2:

• d1i9rm2 is new in SCOP 1.61
  
• d1i9rm2 appears in SCOP 1.63
  
• d1i9rm2 appears in the current release, SCOPe 2.08