SCOP 1.71: Domain d1i9rm1: 1i9r M:1-111

Lineage for d1i9rm1 (1i9r M:1-111)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (52 PDB entries)

8. Domain d1i9rm1: 1i9r M:1-111 [71157]
   Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rh2, d1i9rk1, d1i9rk2, d1i9rl2, d1i9rm2, d1i9rx1, d1i9rx2, d1i9ry2

Details for d1i9rm1

PDB Entry: 1i9r, 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

SCOP Domain Sequences for d1i9rm1:

Sequence; same for both SEQRES and ATOM records:

>d1i9rm1 b.1.1.1 (M:1-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleik

Timeline for d1i9rm1:

• d1i9rm1 first appeared in SCOP 1.61
  
• d1i9rm1 appears in SCOP 1.69
  
• d1i9rm1 appears in SCOP 1.73
  
• d1i9rm1 appears in the current release, SCOPe 2.08