SCOP 1.65: Domain d1i9rk2: 1i9r K:119-219

Lineage for d1i9rk2 (1i9r K:119-219)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1i9rk2: 1i9r K:119-219 [71154]
   Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh1, d1i9rk1, d1i9rl1, d1i9rl2, d1i9rm1, d1i9rm2, d1i9rx1, d1i9ry1, d1i9ry2

Details for d1i9rk2

PDB Entry: 1i9r, 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

SCOP Domain Sequences for d1i9rk2:

Sequence; same for both SEQRES and ATOM records:

>d1i9rk2 b.1.1.2 (K:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1i9rk2:

• d1i9rk2 first appeared in SCOP 1.61
  
• d1i9rk2 appears in SCOP 1.63
  
• d1i9rk2 appears in SCOP 1.67
  
• d1i9rk2 appears in the current release, SCOPe 2.08