SCOP 1.75: Domain d1i9rh1: 1i9r H:1-118

Lineage for d1i9rh1 (1i9r H:1-118)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (67 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831
   SQ NA # humanized antibody
   SQ NA # Humanized antibody
   SQ NA # engineered antibody
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d1i9rh1: 1i9r H:1-118 [71151]
   Other proteins in same PDB: d1i9ra_, d1i9rb_, d1i9rc_, d1i9rh2, d1i9rk2, d1i9rl1, d1i9rl2, d1i9rm1, d1i9rm2, d1i9rx2, d1i9ry1, d1i9ry2

Details for d1i9rh1

PDB Entry: 1i9r, 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody

PDB Compounds: (H:) immunoglobulin h

SCOP Domain Sequences for d1i9rh1:

Sequence; same for both SEQRES and ATOM records:

>d1i9rh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
qvqlvqsgaevvkpgasvklsckasgyiftsyymywvkqapgqglewigeinpsngdtnf
nekfkskatltvdksastaymelsslrsedtavyyctrsdgrndmdswgqgtlvtvss

Timeline for d1i9rh1:

• d1i9rh1 first appeared in SCOP 1.61
  
• d1i9rh1 appears in SCOP 1.73
  
• d1i9rh1 appears in SCOPe 2.01
  
• d1i9rh1 appears in the current release, SCOPe 2.08