Lineage for d1i9rc_ (1i9r C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048772Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2048773Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2048774Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2048869Protein Extracellular domain of CD40 ligand [49844] (1 species)
  7. 2048870Species Human (Homo sapiens) [TaxId:9606] [49845] (2 PDB entries)
  8. 2048874Domain d1i9rc_: 1i9r C: [71150]
    Other proteins in same PDB: d1i9rh1, d1i9rh2, d1i9rk1, d1i9rk2, d1i9rl1, d1i9rl2, d1i9rm1, d1i9rm2, d1i9rx1, d1i9rx2, d1i9ry1, d1i9ry2
    complexed with zn

Details for d1i9rc_

PDB Entry: 1i9r (more details), 3.1 Å

PDB Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody
PDB Compounds: (C:) cd40 ligand

SCOPe Domain Sequences for d1i9rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9rc_ b.22.1.1 (C:) Extracellular domain of CD40 ligand {Human (Homo sapiens) [TaxId: 9606]}
npqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfc
snreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvf
vnvtdpsqvshgtgftsfgllkl

SCOPe Domain Coordinates for d1i9rc_:

Click to download the PDB-style file with coordinates for d1i9rc_.
(The format of our PDB-style files is described here.)

Timeline for d1i9rc_: