![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein Extracellular domain of CD40 ligand [49844] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49845] (4 PDB entries) |
![]() | Domain d1i9rb_: 1i9r B: [71149] Other proteins in same PDB: d1i9rh1, d1i9rh2, d1i9rk1, d1i9rk2, d1i9rl1, d1i9rl2, d1i9rm1, d1i9rm2, d1i9rx1, d1i9rx2, d1i9ry1, d1i9ry2 complexed with zn |
PDB Entry: 1i9r (more details), 3.1 Å
SCOPe Domain Sequences for d1i9rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9rb_ b.22.1.1 (B:) Extracellular domain of CD40 ligand {Human (Homo sapiens) [TaxId: 9606]} npqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfc snreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvf vnvtdpsqvshgtgftsfgllkl
Timeline for d1i9rb_: