Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries) |
Domain d1i9jl2: 1i9j L:113-219 [71147] Other proteins in same PDB: d1i9jh1, d1i9jh2, d1i9jl1 part of anti-testosterone Fab complexed with tes |
PDB Entry: 1i9j (more details), 2.6 Å
SCOP Domain Sequences for d1i9jl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9jl2 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1i9jl2: