Lineage for d1i9jl2 (1i9j L:113-219)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289864Domain d1i9jl2: 1i9j L:113-219 [71147]
    Other proteins in same PDB: d1i9jh1, d1i9jh2, d1i9jl1
    part of anti-testosterone Fab
    complexed with tes

Details for d1i9jl2

PDB Entry: 1i9j (more details), 2.6 Å

PDB Description: testosterone complex structure of the recombinant monoclonal wild type anti-testosterone fab fragment
PDB Compounds: (L:)

SCOP Domain Sequences for d1i9jl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9jl2 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1i9jl2:

Click to download the PDB-style file with coordinates for d1i9jl2.
(The format of our PDB-style files is described here.)

Timeline for d1i9jl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i9jl1