![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries) |
![]() | Domain d1i9jh2: 1i9j H:119-220 [71145] Other proteins in same PDB: d1i9jh1, d1i9jl1, d1i9jl2 part of anti-testosterone Fab complexed with tes |
PDB Entry: 1i9j (more details), 2.6 Å
SCOP Domain Sequences for d1i9jh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9jh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
Timeline for d1i9jh2: