SCOP 1.73: Domain d1i9il2: 1i9i L:113-219

Lineage for d1i9il2 (1i9i L:113-219)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1i9il2: 1i9i L:113-219 [71143]
   Other proteins in same PDB: d1i9ih1, d1i9ih2, d1i9il1
   part of anti-testosterone Fab

Details for d1i9il2

PDB Entry: 1i9i, 2.72 Å

PDB Description: native crystal structure of the recombinant monoclonal wild type anti-testosterone fab fragment

PDB Compounds: (L:) recombinant monoclonal anti-testosterone fab fragment light chain

SCOP Domain Sequences for d1i9il2:

Sequence; same for both SEQRES and ATOM records:

>d1i9il2 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1i9il2:

• d1i9il2 first appeared in SCOP 1.61
  
• d1i9il2 appears in SCOP 1.71
  
• d1i9il2 appears in SCOP 1.75
  
• d1i9il2 appears in the current release, SCOPe 2.08