| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries) |
| Domain d1i9ih2: 1i9i H:119-220 [71141] Other proteins in same PDB: d1i9ih1, d1i9il1, d1i9il2 part of anti-testosterone Fab |
PDB Entry: 1i9i (more details), 2.72 Å
SCOP Domain Sequences for d1i9ih2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9ih2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
Timeline for d1i9ih2: