Lineage for d1i9cd_ (1i9c D:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 238063Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (3 families) (S)
  5. 238097Family c.1.19.2: Glutamate mutase, large subunit [51707] (1 protein)
  6. 238098Protein Glutamate mutase, large subunit [51708] (1 species)
  7. 238099Species Clostridium cochlearium [TaxId:1494] [51709] (3 PDB entries)
  8. 238105Domain d1i9cd_: 1i9c D: [71139]
    Other proteins in same PDB: d1i9ca_, d1i9cc_
    complexed with 3md, 5ad, b12, glu; mutant

Details for d1i9cd_

PDB Entry: 1i9c (more details), 1.9 Å

PDB Description: glutamate mutase from clostridium cochlearium: complex with adenosylcobalamin and substrate

SCOP Domain Sequences for d1i9cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9cd_ c.1.19.2 (D:) Glutamate mutase, large subunit {Clostridium cochlearium}
melknkkwtdeefhkqreevlqqwptgkevdlqeavdylkkipaeknfaeklvlakkkgi
tmaqpragvalldehiellrylqdeggadflpstidaytrqnrydecengikesekagrs
llngfpgvnfgvkgcrkvleavnlplqarhgtpdsrllaeiihaggwtsnegggisynvp
yaknvtiekslldwqycdrlvgfyeeqgvhinrepfgpltgtlvppsmsnavgitealla
aeqgvknitvgygecgnmiqdiaalrcleeqtneylkaygyndvfvttvfhqwmggfpqd
eskafgvivtattiaalagatkvivktpheaigiptkeanaagikatkmalnmlegqrmp
mskeletemavikaetkcildkmfelgkgdlaigtvkafetgvmdipfgpskynagkmmp
vrdnlgcvrylefgnvpfteeiknynrerlqerakfegrdvsfqmviddifavgkgrlig
rpe

SCOP Domain Coordinates for d1i9cd_:

Click to download the PDB-style file with coordinates for d1i9cd_.
(The format of our PDB-style files is described here.)

Timeline for d1i9cd_: