Lineage for d1i9cc_ (1i9c C:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177542Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 177870Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 177871Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (3 proteins)
  6. 177872Protein Glutamate mutase, small subunit [52246] (2 species)
  7. 177873Species Clostridium cochlearium [TaxId:1494] [52248] (4 PDB entries)
  8. 177879Domain d1i9cc_: 1i9c C: [71138]
    Other proteins in same PDB: d1i9cb_, d1i9cd_

Details for d1i9cc_

PDB Entry: 1i9c (more details), 1.9 Å

PDB Description: glutamate mutase from clostridium cochlearium: complex with adenosylcobalamin and substrate

SCOP Domain Sequences for d1i9cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i9cc_ c.23.6.1 (C:) Glutamate mutase, small subunit {Clostridium cochlearium}
mekktivlgvigsdchavgnkildhaftnagfnvvnigvlspqenfikaaietkadailv
sslygqgeidckglrqkcdeaglegillyvggnivvgkqhwpdvekrfkdmgydrvyapg
tppevgiadlkkdlnie

SCOP Domain Coordinates for d1i9cc_:

Click to download the PDB-style file with coordinates for d1i9cc_.
(The format of our PDB-style files is described here.)

Timeline for d1i9cc_: